PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G182500.1
Common NameB456_004G182500, LOC105791901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 373aa    MW: 41714.6 Da    PI: 8.8911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G182500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32193246255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.004G182500.1 193 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28191246IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23193246IPR006447Myb domain, plants
PfamPF002492.4E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNIK PTSRGLDSRS SMSSMAKPDN CFELSFSNPR VSDSNSNHFH  60
QLLQNGSATA NCNGNLFQSY HHNQFPHHHN QLQHPLLYQH QHHHQQHQQG LGQEFGFLRP  120
IRGIPVYQNP PPPPPSPPFP FAQQPLDSSL PSSPSYLATT KIGNTSLNPF QSQGLMRSRF  180
MSRSPAKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DRAAASSGQM DAFENGSSGD TSEDMMFEIQ NPRRSEISVQ QGRSSSSNAH  300
QDKEYHGLWS NSSREAWLHG KPNDSPLNLP SLQKDMDPKC LSYERISDVS SSSLSETCSK  360
KPNLEFTLGV PH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475654.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6169e-82KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2QZX50.0A0A0D2QZX5_G
STRINGPOPTR_0001s02010.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.17e-74G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]